Şişlide profesyonel ev taşımacılığını çok uygun fiyata yapıyoruz.

1.67 Rating by CuteStat

sislievdenevenakliyatfirmalari.com is 9 years 1 month old. It is a domain having com extension. It has a global traffic rank of #3010344 in the world. This website is estimated worth of $ 240.00 and have a daily income of around $ 1.00. As no active threats were reported recently by users, sislievdenevenakliyatfirmalari.com is SAFE to browse.

PageSpeed Score
86
Siteadvisor Rating
Not Applicable

Traffic Report

Daily Unique Visitors: 160
Daily Pageviews: 320

Estimated Valuation

Income Per Day: $ 1.00
Estimated Worth: $ 240.00

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: 3,010,344
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

78.135.87.149

Hosted Country:

Türkiye TR

Location Latitude:

41.0214

Location Longitude:

28.9948

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: 4 H2 Headings: 1
H3 Headings: 5 H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 12
Google Adsense: Not Applicable Google Analytics: UA-36553133-10

Websites Hosted on Same IP (i.e. 78.135.87.149)

Page not found

- weaklight.net
Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Content-Encoding: gzip
Vary: Accept-Encoding
Transfer-Encoding: chunked
Date: Mon, 30 Mar 2015 01:05:08 GMT
Connection: close
X-Pingback: http://sislievdenevenakliyatfirmalari.com/xmlrpc.php
Content-Type: text/html; charset=UTF-8

Domain Information

Domain Registrar: FBS INC.
Registration Date: Mar 20, 2015, 12:00 AM 9 years 1 month 3 weeks ago
Last Modified: Mar 21, 2015, 12:00 AM 9 years 1 month 3 weeks ago
Expiration Date: Mar 20, 2016, 12:00 AM 8 years 1 month 4 weeks ago
Domain Status:
clientTransferProhibited http://www.icann.org/epp#clientTransferProhibited

Domain Nameserver Information

Host IP Address Country
ns1.arvasajans.com 185.90.242.142 Türkiye Türkiye
ns2.arvasajans.com 185.90.242.142 Türkiye Türkiye

DNS Record Analysis

Host Type TTL Extra
sislievdenevenakliyatfirmalari.com A 14399 IP: 78.135.87.149
sislievdenevenakliyatfirmalari.com NS 21599 Target: ns2.arvasajans.com
sislievdenevenakliyatfirmalari.com NS 21599 Target: ns1.arvasajans.com
sislievdenevenakliyatfirmalari.com SOA 21599 MNAME: ns1.arvasajans.com
RNAME: vantube.hotmail.com
Serial: 2015032103
Refresh: 86400
Retry: 7200
Expire: 3600000
Minimum TTL: 86400
sislievdenevenakliyatfirmalari.com MX 14399 Target: sislievdenevenakliyatfirmalari.com

Similarly Ranked Websites

Personal Trainers & Training Courses UK

- nrpt.co.uk

Since 1999, the NRPT.co.uk has provided personal trainers across the UK with our directory. These are insured and qualified to Level 3. We also work with leading providers of training courses for becoming a PT.

3,010,345 $ 480.00

Half Past Human

- halfpasthuman.com
3,010,352 $ 480.00

Home - Cowtown Rodeo

- cowtownrodeo.com
3,010,355 $ 480.00

heiminfo.ch

- heiminfo.ch
3,010,364 $ 480.00

Tech Lifestyle News — The Latest in Technology

- techlifestylenews.com

The Latest in Technology

3,010,366 $ 480.00

Full WHOIS Lookup

Whois Server Version 2.0

Domain names in the .com and .net domains can now be registered
with many different competing registrars. Go to http://www.internic.net
for detailed information.

Domain Name: SISLIEVDENEVENAKLIYATFIRMALARI.COM
Registrar: FBS INC.
Sponsoring Registrar IANA ID: 1110
Whois Server: whois.isimtescil.net
Referral URL: http://www.isimtescil.net
Name Server: NS1.ARVASAJANS.COM
Name Server: NS2.ARVASAJANS.COM
Status: clientTransferProhibited http://www.icann.org/epp#clientTransferProhibited
Updated Date: 21-mar-2015
Creation Date: 20-mar-2015
Expiration Date: 20-mar-2016

>>> Last update of whois database: Mon, 30 Mar 2015 01:04:54 GMT